SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015004 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015004
Domain Number 1 Region: 149-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 467-579
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.22e-28
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 3 Region: 305-418
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 262-299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015004
Domain Number - Region: 425-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015004   Gene: ENSOPRG00000016427   Transcript: ENSOPRT00000016430
Sequence length 582
Comment pep:novel genescaffold:pika:GeneScaffold_1480:934114:938507:-1 gene:ENSOPRG00000016427 transcript:ENSOPRT00000016430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSEVIVCLEAAELSKTEFCNPAFEPEAEQPCHSPAFQEDTPHSGPAPWPGRHPGRLQ
PDCRFSWLCVLLLAGLLLLLLGLLVAIILAQLQAAPPSSATYGPLPARGLPTTASVTTTL
TTTTMAPWALGTPGRLREEGMSPMTQSACGGLLPGPRGFFSSPNYPDPYPPHAHCVWHIQ
VATDHMIQLKIEALSMESVASCLFDRLEISPEPEGPLLRVCGKVAPPTLNTNTSRLRVAF
VSDGSVEGSGFQAWYQAVTPGHGSCAHDEFFCDQLICLLTDSVCDGFANCVDGSDEANCS
AKSWGCGGNVTGLQGTFSAPSYLQQYPHHQLCTWHISVPTGHGIELQFHFSLEAXXXXXX
XXXXXXXXXXXXXXXXXXXFCGAEPPPRLVSSHHELAVLLRTDRGISSGGFSATFRAFNA
TENPCGPREFCQDGGCKSLQWVCDMWRDCTDGSRDNCTSPLFPAPELACEPVQVEMCLGL
SYNTTAFPNIWVGMATQEEVGEVLRGYKSLTSLPCYQHFQRLLCGLLVPRCTSLGSVLPP
CRSVCQEAERQCQSGLALLGIPWPFNCNRLPEAAGMATCAHP
Download sequence
Identical sequences ENSOPRP00000015004 ENSOPRP00000015004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]