SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015196 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015196
Domain Number 1 Region: 229-358
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-22
Family Cadherin 0.0058
Further Details:      
 
Domain Number 3 Region: 338-442
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-22
Family Cadherin 0.0059
Further Details:      
 
Domain Number 4 Region: 437-486
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000002
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 28-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000857
Family Cadherin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015196   Gene: ENSOPRG00000016647   Transcript: ENSOPRT00000016638
Sequence length 506
Comment pep:known_by_projection scaffold:pika:scaffold_3448:162641:165239:1 gene:ENSOPRG00000016647 transcript:ENSOPRT00000016638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQTKARHDKRQVAILMVLMLLWEVGSESIQYSVLEETESGTFVANLTKDLGLGVGELAS
RGARVVFKGNRQPLQLDPYTHDLLLNEKLDREELCGSTEPCVLPFQVLLEKPLQFFQAAL
LIRDINDHAPEFPAREMVLKISEITAPGKIFPLKMAQDLDAGSNSLQSYTVSSNAHFHVV
TRNRSDGRKFPELVLDKALDREEQPHLELTLTAQDGGSPPRSGTAKIKILVLDSNDNAPE
FVQERYEAQVPENSPPGYRVLTVLARDSDAGSFGEVSYALFQVDDVNQPFEIDTITGEVR
LRKTMDFEEFQSYHVDIEATDGGGLTGKCSLFVNVLDVNDNAPELIMSSLFSPVPENARD
MVVAVFSVSDADSGRNQEVVCSIDDKLPFFLRASMENFYTLVTDGPLDREARAQYTITIT
VSDLGTPRLQSQHNVTVHVSDVNDNAPTFSQALYTLFVLENNSPALHIGSVSASDRDAGA
NAQITYSLTGIEIENSPSIRNSFPFS
Download sequence
Identical sequences ENSOPRP00000015196 ENSOPRP00000015196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]