SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015199 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015199
Domain Number 1 Region: 1217-1347
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-33
Family Cadherin 0.00081
Further Details:      
 
Domain Number 2 Region: 1327-1430
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 1432-1535
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 1939-2042
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 2162-2265
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 449-570
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-23
Family Cadherin 0.00086
Further Details:      
 
Domain Number 7 Region: 1768-1852
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 8 Region: 2046-2162
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 9 Region: 2267-2374
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 10 Region: 1845-1943
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 791-847,1166-1221
Classification Level Classification E-value
Superfamily Cadherin-like 1.98e-18
Family Cadherin 0.0088
Further Details:      
 
Domain Number 12 Region: 1531-1636
Classification Level Classification E-value
Superfamily Cadherin-like 3e-18
Family Cadherin 0.0047
Further Details:      
 
Domain Number 13 Region: 357-461
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-17
Family Cadherin 0.0077
Further Details:      
 
Domain Number 14 Region: 2372-2481
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 15 Region: 566-644
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000157
Family Cadherin 0.0079
Further Details:      
 
Domain Number 16 Region: 753-798
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000183
Family Cadherin 0.027
Further Details:      
 
Domain Number 17 Region: 1644-1697
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000771
Family Cadherin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015199   Gene: ENSOPRG00000016620   Transcript: ENSOPRT00000016641
Sequence length 2868
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4956:4371:307573:-1 gene:ENSOPRG00000016620 transcript:ENSOPRT00000016641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNELTEAENIRKMRTQQIQSTDGCRQEACLKRNPNETTERKNSSKIELRSPPGVRGKEET
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDLQRMPLTLMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIIYSASMLSHLESATLLLIVSAQDGGGLTADTNAHITLHLLQTMLAPAEFER
PKYTFSVYEDVPINSLVGTVKAREHLNSSEPNEYRISSGDLDETFSIHPWLGTIHTRKPL
DHETQPVVVLTVQAQLVGSSAYSNTEVNITVIDVNDNHPTFPTASDEIKISQSTAPGTAL
YLARAEDKDSGLNGFIRYSIASPNPSVFAIHRELGVVHLSASLAGDGLRNYTLTLRAQDL
GTPPRASLLVLTVVVEPQDQSRPLAFQNFIYQVEVSESLSVMTQLLQIQAFPCGPQATAS
QPAYSLEPGLSSAMFGIHPYTGWIYLRRQLDYESIQTYSFRAFAWIPDRLSQNVXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXWVMASKGPDFELIAGGSVPKPPPCELMSWLALDRELQGHHRVTVLVTDHGSPPRNA
TTTVHITVSDVNDNRPFFPQCLPGGELHIKVLEGQPVNMLVTTVFAKDLDEGNNAEVTYS
VLSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLSTACSLDYETQSQHLLTLL
ALDHGTPALSSTQTLTVNVVDVNDEAPVFKQHIYEASVKENQNPGEFVARVEAVDGDSGV
NSKLQFEIMPGVSSDLFEINPDTGEIVTTTMFDREVQQIFTLRVLARDGGVPSLSGTTTV
LCIIEDVNDHAPEFITTSHDIEIPENREPEIISTVWASDRDAGNNGAVTYHIIGGNTDEY
FAIHETSGELLTTRALDREQVSSFTLVLLASDLGVPPRSSILQVHIRVLDDNDHSPAFPI
LHYQASVAEDAQVGTPVLVLSAVDEDEGLNGHIEYFLMDAASGTFTIDHATGTLRTGHTL
DREARSEHTFRAVARDRGMQGSRSTTIMVTVHVMDVNDNNPVWGQNPSDVLLCSWSLPNQ
KVAILRASDLDLGPNGTVIFSFAETQSMFSIDQHTGEIKLQQNLSQENFPMWLHLRVTDQ
GVPARATTGLLVVHMEGEDVRISFSDPLYEGLVMEDCEAGTSIVTVKALATDSIQDSIEY
SIFSGNEDKTFSLDSQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVFATDPDSGLNGLLEYSIIAGNHGEVFWIDAQ
SGMITTGAVLDYEASSSYSLVVQAKDGGTPSLSATTVVNVQVVDLNDNAPFFLPQAVEIA
ENSLPGTIVSRVSVHDVDLNPAFVFNFIKESDPGNKFTIDQNTGEVLLVKNLDFEEANEY
KLLIQISDWVHITECVLTVQVLDINDNPPVFSQDFYQVTIPESVPVGYSVLTVSATDIES
KENISYRMISSSKHFSIDPKNGTVFITNPILLLDEISTVQFLVEASDEGIPNLRTLALVE
VKIRDVNDHAPEFTVECYNQSLSEDTAVGSVVLRFATLDQDWTRENTYVEYSILSGDSQN
NFYVGTSFTDSEHPSQQAGYLMLLHSLDREVAASHQLVILASDRGCPPLSSTAVVFIEVL
DVNDNPPEFSSLQYHAQVKESTPPGSSLTVVSAGDRDTGIGAQIIYTIISGNEKGQFHLE
KNTGILYLMKPLDYEDRIRFTLTVQAANEEMEHFSFASVFVSVLDDNDHAPQFLFSSLSC
AVPENLPVFSTLCSVNALDLDAGPYGELTYSMSSPCHVPPGMPSGFDLFRIDSLTGEIHA
KQALDYENGSKYCLVVEAKDKGDATASMVVWVDIEGIDEFEPVFTQDQYFFHLPENNEVG
PLIGRVEASDADAGLDGVVLYSLGTSSPFFSVNATTGHIYLVRSIPLVQSQVSKDTMLEV
KILAHSPKVDSRTAMCTVFVNMSLLQEGQHSVATHSSFFVSFAVSVLVFLLLVCILLMLI
LRHKQKHTVDDYKKKTSLPLDASLRPSVDASAFKTFQEDNDCRVEVVPVDHTPEWLSLLS
VMEKDLATLYRHSNSSGHCSVEGETAEDKEIQRINEHPYRKDLDSALSDRESRVPDSGIP
RDSDQLSCLSVETDVTVTAEAADVSSMVEGADRGANHNTTCTPKNGSPQALQKGETKKDI
LADVTGVRAAAGSALPALRTADPEGRSSYPWDCLLSWEPKFQSLSSVFYDIAKLKDEHSQ
RPGMSKGKSSGVFPPPLITAIAQPGIKAVPPRMPAAPPGHVLQRHPRSPLLYHLASMTEA
MTPSVSPSLSMLTLQNPAMSPLLSDGDILGLHVNDTHPELKAEDEVQI
Download sequence
Identical sequences ENSOPRP00000015199 ENSOPRP00000015199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]