SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015201 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015201
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.04e-52
Family Proteasome subunits 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015201   Gene: ENSOPRG00000016646   Transcript: ENSOPRT00000016643
Sequence length 190
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2301:58463:93605:-1 gene:ENSOPRG00000016646 transcript:ENSOPRT00000016643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSVYEAPVGGFSFENCRRNAVLEADFAQKGYKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDITGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDME
Download sequence
Identical sequences ENSOPRP00000015201 ENSOPRP00000015201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]