SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015428 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015428
Domain Number 1 Region: 441-566
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-28
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 236-340
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-22
Family Cadherin 0.0038
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0056
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-18
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 28-106
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000357
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015428   Gene: ENSOPRG00000016905   Transcript: ENSOPRT00000016896
Sequence length 817
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5156:26808:29263:1 gene:ENSOPRG00000016905 transcript:ENSOPRT00000016896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLQKLPSCAGLVPLHLLLAVLWVATAKHIRYSVPEELEKGSLVGNISKDLGLEPRELV
ERGVRIISRGRAQLFALNARSGGLVTASRIDREELCAQSLRCLVTLNILLEDKLTIYSVE
VEIKDVNDNAPRFGSEELEIKISETTTPGFRIPLRSAHDADVGENTLQKYELNQNDHFSL
DVRSGADGNKYPELVLERPLDREQEAAHHLLLVASDGGDPVLFGTSRILVNVLDANDNAP
VFTQPEYRVSVAENVAVGTRILTVSATDADDGYNAQVAYFQEKTPGETSHVFELQSTSGD
LIVVKPLDYEDAKFHEIDIEAQDGPGLVSRAKVSITVLDVNDNAPELHVTSAVSSVAEDS
PPGTVIALFNVQDRDSGQNAFVTCSLPESLPFKLEKSVDDYHRLVTSGALDRERVAFYNI
TLTARDAGDPPLSKDAHIWLTVADINDNAPAFGRLSYSTYVPENNPRGASIFSMIAQDPD
SDGNAHVTYSLVEDTIQGAPLSSYVSINSDTGVLYALCSFDYEQFQDLQLWVTASDNGEP
PLSSNASLTLFVLDQNDNAPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPAVLADLGSLKPSVEADEADLTLYLVVAVATVSCVFLAFVIVLLALRLRRWH
KSRLLQASGGLPASHLVGVDGVRAFLQTYSHEVSLTADSRRSHLIFPQPNYADTLLSMSQ
ESCGKKDFPSTPQSLVEDEKDVISQVKFLFSICLLLK
Download sequence
Identical sequences ENSOPRP00000015428 ENSOPRP00000015428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]