SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015442 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015442
Domain Number 1 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.02e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 3 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 8.16e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Domain Number 4 Region: 139-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.00000000000301
Family N-terminal domain of cbl (N-cbl) 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015442
Domain Number - Region: 926-970
Classification Level Classification E-value
Superfamily UBA-like 0.000108
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015442   Gene: ENSOPRG00000016906   Transcript: ENSOPRT00000016912
Sequence length 980
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3950:254680:428133:-1 gene:ENSOPRG00000016906 transcript:ENSOPRT00000016912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCTGPLANSLSEKTKDMVEDDDDEYKIPSSHPVSLN
SQSSHCHNVKPPVRSCDNGHCILNGTHGTSSEIKKSTISELGIYLKGDVFDSASEPVPLP
PARPPTRDSPKHGSALNRTPSDYDLLIPPLGEDAFEALPPSLPPPPPPARHSLMEPSKPP
GSGSRPSSGHDLFLLPSDPFFDPSSGQVPLPPARRLPGENVKSNRTSQDCDQLPSSSDGS
QAPARPPKPRPRRTAPEIHHRKPHGPEAAMESVDAKIAKLMGEGYAFEEVKRALEIAQNN
VEVARSILREFAPPPVPRHL
Download sequence
Identical sequences ENSOPRP00000015442 ENSOPRP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]