SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015515 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015515
Domain Number 1 Region: 497-603
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-30
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 155-297
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-21
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 378-497
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-17
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 598-688
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-17
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 349-387
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000642
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015515   Gene: ENSOPRG00000016989   Transcript: ENSOPRT00000016993
Sequence length 1233
Comment pep:novel genescaffold:pika:GeneScaffold_5156:541892:566735:-1 gene:ENSOPRG00000016989 transcript:ENSOPRT00000016993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRVRRPCPKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVSITDLVQHGSPRLLEGQIEVQDINDYSPNFASPVITLTIPENT
NIGSLFPIALAFRRDAPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRER
WDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLSTLRFSVLAKDR
GANPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDR
DEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSG
NPPLSSTNSLKVQVVDVNDNAPIFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELV
YSLEPEPAAKGLFTISPDSGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNV
LDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAHVQLSEQDNGDFVIQNG
TGTILSSLSFDREQQSTYTSLKAVDGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLPHRRVTFSATSQAQELQDPSQHSYYDSGLEESETPSSKSSSGPRLGPLAL
PEDHYERTTPDGSIGEMEHPENXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYSAFSHSSHDSCKD
SATLEEIPLTQTSDFPPTATPASAQTTKREIYL
Download sequence
Identical sequences ENSOPRP00000015515 ENSOPRP00000015515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]