SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015528 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015528
Domain Number 1 Region: 444-565
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 233-351
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 130-237
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-21
Family Cadherin 0.005
Further Details:      
 
Domain Number 4 Region: 341-448
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 613-690
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000471
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015528
Domain Number - Region: 29-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.00343
Family Cadherin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015528   Gene: ENSOPRG00000017011   Transcript: ENSOPRT00000017007
Sequence length 1180
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5156:627545:641710:-1 gene:ENSOPRG00000017011 transcript:ENSOPRT00000017007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMRLLWLLLGLWGPESYLFLPGDCQEITTLTVKYQVTEEVPSGTVIGTLSQDLGWEDGQQ
RRTGPAFQVLQLPQALPIQVDSGDGSLSTGRQLDREQLCRQRDPCLVSFDVLATGDLALI
HVEIQVLDINDHHPQFPKGQQELEISESAALHTRIPLDRALDPDTGPNTLHSYTLSPSEH
FALDVIVGPDNTKHAELVVVKELDREVHSSFDLTLTAYDSGDPPKSGTSLVKVNVLDSND
NSPVFAESSLALEIREDAAPGTLLVNLTATDPDQGPNGEVEFFSKHVAELDTFSVDKTGQ
VILRQPLDYERNPAYEVDQARDLGPNPIPAHCKVLIKVLDVNDNVPSIHITWASQSPLVA
EDLPKDSFIALVVAEDLDSGNNGLVHCWLKQELGHFRLKRTNGNTYMLLTNATLDREQWP
QYNLTVLAQDQGPQPLSARRQFSIEIGDANDNPPVFEKSRYEVSTRENNLPSLHLITVKA
YDQDLGMNGKITYCIQDSPVSHLVAIDPDTGVVTAQKSLDYEEMADFEVQVIAKDRGQPQ
LAASVSIWVSLLDANDNTPQVIWPVLSAGRASLSVLVNASTGHLLVPVETSGGLGTSTGT
QMPYLATLGSKPFLLTTIVAKDADSGANGELLYGIRRGNEAGLFMLSPHLGQLFINVTNA
SSLIGSEWELEIVVEDRGSPALHTRALLQVLFLSSVDHLRDSAHELGTLSVSVLTVICLA
VLLAAFGSGLALFMSICRTEKKDSRAYNCREAESTYRQQPKRPQKHIQKTDIHLVPVLKG
HAEEPDEVGPSHRDVGKEAMVEAGWDSCLQAPCHLTPTLYRTLRNQGNQGVLAESPEVLQ
DTVNLLFNHPRQRNASRENLCLPEPQPTPGQSRSRAFKVTGSPTARLAGDQGSQEAPVSP
PASSATLRRQRNLNGKVTPEKESGPHQILRSLVRLSVAAFAERNPVEELTVDSPPVQQIS
QLLSLLHQGQFQPKPNHRGNKYLAKPGGGRSATPDSDGLSTRGDSPAEPDLEEGHIDPEE
DLSVKRLLEEELSNLLDPHTGLAVDLQSVPDPAWMARLSLPLTTNYRDNVISPDAAASEE
PRTFQTFGKEAGPELSPAGTRLASTFVSEMSSLLEMLLEQRSSVPVEAASEALRRLSVCG
RTLSLDLATGRTSGPEGRGGPGGKRTRGSSSSSSSSSRCL
Download sequence
Identical sequences ENSOPRP00000015528 ENSOPRP00000015528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]