SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015800 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015800
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.05e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 6e-23
Family Cadherin 0.00089
Further Details:      
 
Domain Number 3 Region: 372-492
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-21
Family Cadherin 0.005
Further Details:      
 
Domain Number 4 Region: 67-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000275
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 550-596
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015800   Gene: ENSOPRG00000017311   Transcript: ENSOPRT00000017311
Sequence length 796
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2526:296031:342864:-1 gene:ENSOPRG00000017311 transcript:ENSOPRT00000017311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENYCLQAALVCLGMLCHSQAFSPEWRSHPRPSLHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPLNVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYTIIDGDGMELFEITTDYETQEGVVKLKKPVDFETKRVYNLRVEATNVHIDPNFIN
NGPFKDGATIKITVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIXXX
XXXHTDLDRFFTINPEDGFIKTTKPLDREETAWLNISVFAAEIHNRHQEAKVPVAIRVLD
VNDNAPRFAAPYEGFICESDQTKPLSNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDDS
Download sequence
Identical sequences ENSOPRP00000015800 ENSOPRP00000015800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]