SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000016109 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000016109
Domain Number 1 Region: 441-566
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-30
Family Cadherin 0.0022
Further Details:      
 
Domain Number 2 Region: 230-347
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-29
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-24
Family Cadherin 0.0049
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-22
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 556-650
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000014
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 30-99
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000286
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000016109   Gene: ENSOPRG00000018504   Transcript: ENSOPRT00000018864
Sequence length 651
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5156:59396:61349:1 gene:ENSOPRG00000018504 transcript:ENSOPRT00000018864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATARGRQPRRELLLLFTLLQILWGAGAGQIRYSIPEELEKGSLVGDIAKDLGLEPRELV
ERGVRIISRGRAQLFALNARSGGLVTAGRIDREELCAQSAQCLVGLNVLVEEKMKLYSVE
VEIADINDNAPRFSREEFEVKILENAAPSSHFPLMEVYDPDVGMNSLQGFRLSENSHFSV
AVQSEVQGREYPELVLERALDREVEAAHRLVVTAVDGGDPARSGVARILVTVLDANDNAP
VFTQPVYRVSVPEDLPVGSLVLPVNATDQDEGAHAQVTYSFVKIPEEISRIFCLDIVTGE
ISTSAELDYEVSSSYELEVEARDRPGLRGRAKVFITVLDVNDNAPEVMLTSGTRTVAESA
PVGTVIGLFQVYDRDSGVNGLVACSIPTNLPFELEKTVDNYYRLVTTAALDRERVSLYNV
TVTATDRGTPPLSTQTLISLQVADTNDNPPAFPLSSYAIYVPENNPRGASIFFVTAMDPD
SDHNAQVTYSLAEDTVQGVPLSSYVSINSDTGVLYALRSFDYEQFRDLQLWVTASDSGEP
PLSSNASLTLFVLDQNDNAPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQ
Download sequence
Identical sequences ENSOPRP00000016109 ENSOPRP00000016109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]