SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CC1G_05120T0 from Coprinopsis cinerea okayama7 130 v3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CC1G_05120T0
Domain Number 1 Region: 496-838
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-59
Family PIWI domain 0.018
Further Details:      
 
Domain Number 2 Region: 243-399
Classification Level Classification E-value
Superfamily PAZ domain 8.79e-29
Family PAZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CC1G_05120T0
Sequence length 885
Comment | CC1G_05120 | Coprinopsis cinerea okayama7#130 hypothetical protein (886 aa)
Sequence
MSRETFTEVKVITNSFPLLKLPSVAYAQYRDFNPDFNEGKNFVKKREYVHHLQTKVANDI
FGRHYFLYDGRELGYAEPELQKILGPAKTFYADLRSTRLFSPTEFIPPTGKGKLKTKTPC
VEIKFTRTSGPLIGYQEISYVMGNLRNPEAKERRENVTNFLQLILRHNTNNTYPNNGKTY
FPYTVRDVEEDDNNRRRMRLPRDSIRDAERIPSSGLELRRGLFHSIRPTFDRMIVTVDTS
VAIFIPGGPLQDVIGTFLDQHNLRSLREGTPQFRKMVQYFKNVKIRVKVPEKNSEVTKTI
RNFVSSGGHFMFEGPDGEMSVAEHYLRTHNYRVRVPQAPGVVIRENPVKVVVPMELCELV
ENQMFRRKRPEETAHMVRFSIIRPQDRLKKIKQAARNYDAYEALVQAGMEIGRDPLTVDG
KLLTVPTLVYGNGDRMASLSSSIELGMNAKPPLVQRSLVDSASTQGDLVALVKECAAIAG
RIHNINLLDDHLRRFMLVVILPEDALNLKAKVKYFGDITHGVPTQCLRVSKLLDPKSRRL
KQPRQLNQYFNNVALKINARLRGVNVMLESKIPGGSPLAILSTQGRKTMIIGVDVSHPGP
GVTNRPSVASLVFSLYQGGAQYAATTTIQKPRLEKVEQLASMFTYALNSYSAVMEGPPNT
IVYYRDGVSEGEYTTIFEDEMAKLEGGDFAFVFLRDLAYAFSPAGFLEFKEQNKGKGPIP
DKLQYTFIVVGKRHHTLLFPPTPDVADSTGNYIPGITVDTGVVQPFVPNFYLQSHSAIQG
TSRSSHYIVLRNDTFPSLLEIERLSFELCHIYAKATRSVSIPAPVYYADLACGRGNFHFS
PTIMGHGIDDSASFVSTGSDKYDDDYWKEVFRKVHVNLQPLMYFL
Download sequence
Identical sequences A8NFX5
CC1G_05120T0 XP_001833420.2.59657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]