SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CC1G_06473T0 from Coprinopsis cinerea okayama7 130 v3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CC1G_06473T0
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily PH domain-like 6.5e-22
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 160-249
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000144
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CC1G_06473T0
Sequence length 550
Comment | CC1G_06473 | Coprinopsis cinerea okayama7#130 hypothetical protein (551 aa)
Sequence
MPPQYTLNTEEKDRVKAAIPTPPNKIFYACLARIYYAYPDPEKWSYAGLQGALAFVKDAQ
GILHFKMVDLEGTRGVIWEHELYSGLEYNPDRAFFHSFAGDQCLIGFVFANEVEAKALWK
KVNTKKDAKHSAKPQKQKKSKVAKGGKIDKSMISGPKAGSFIHVAHMGYDADSGFKSHGV
DASWSQLLNDLEGKGIGKEVIDRELEFIKDFVRKEQQQQVRPAKSSKPPPPPAARRSKPP
PPPAPRRSVHVPKDSVSSVSSAGDHTPIANGRPPAPPSRPQTLEPPQPPRPPARPSSASK
PPAPPRPVSSVASAPPPAPPRRPAVSSPNPPPPPSRPQPNGAAATPPPPPRRPALSNPAP
PPRPPVPTRAVAEEDTTSVSTPPPPPPPPPPPPGPPAATGGAPPPPPPPPPPGGAAPPPP
PPPPPPPGGAVPPPPPPPPPAGGSGAPSALASMPPPQPGRGNLLADIQGKGIHVLRKTEK
SEAPAGGSSSSGAGTAAAAAVGGAAAGAAAGAALGGGGDLAGALAAALMERNKRLGDSDD
DEDDDDDDWD
Download sequence
Identical sequences A8NN84
XP_001835070.1.59657 CC1G_06473T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]