SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g23590.1|13101.m02494|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g23590.1|13101.m02494|protein
Domain Number 1 Region: 27-123
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000041
Family Ran-binding domain 0.037
Further Details:      
 
Domain Number 2 Region: 351-647
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000782
Family HspBP1 domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g23590.1|13101.m02494|protein
Sequence length 894
Comment suppressor of Mek, putative, expressed
Sequence
MGEQERREAEGGGGGGEAAAANTSGMQRVKVYRLTDGGKWDDRGTGHVNIDFLEDSKELG
LTVLDEEDNETLLMHNITSEDIYRKQEDTIISWRDPEVATELALSFQEAAGCSYIWDNIC
DIQRNIQFNNLGVGPRPTSVSLEASRVLHSNDESFRSVNGELRELPPVELSNLPLILKTI
LEGGITDQMRVAELITQDREFFPKLLDIFRICEDLENLDDLHMIFKLVRGIILLNSSSIF
DKIFSDEFILDIIGALEYDPDVPKVQKHRAFLKDHVVFKEAIPIKNVSVVSKIHQTYRIG
YLKDVILPRVLDDGTLASLNTMIHSNNAAVISLLKDDSCFIQELFARMRLSNISMESKRE
LVLFLHEFCTLSKSLPLVQQLRLFRDLSGEGVFDIISDVLQSQDRKIVSAGTDVLILFLN
QDPNLLRSYIVQQEGNSLLGLLVKGMVTDFGEAMHCQFLEILRILMDSFTMSGAHRDAVI
EIFYEKHLDYLVDVIASSCPPRNISRASNSAGNTETEVNRTKPEILLNVCELLCFCIVHH
PYKIKCHFLINNAIEKILALTRRREKFLVVAAVRFMRTTISRNDDFLIRHVVKMNLFKPI
IDAFVENGDRYNMLQSGVLELLEYIRKEGLKQLIIYANESFWDQLMKFEHFGSIQAFRLK
YQQYLESAETKLSANVPDIRKKAEERGLEKEEEDYFNEDSDEEDSVRRTKHAQKQDGGAK
LTNGSEADDVSSRPKSGGLVDYADDDDEDFNPPPKEPDRPEEDDEPLTIAKLKRKLMNSK
VDGKQSDGEFHKRQKIETRITSVKIGASTNLVSKRMDDLEKQEPRSPASSSSGSEANGVF
GEHSVHSEEHQRSADNTEASRQAGGDCVNAMGNLSTEKSVNTTNTNDSEPYSVR
Download sequence
Identical sequences LOC_Os01g23590.1|13101.m02494|protein 39947.LOC_Os01g23590.1 LOC_Os01g23590.1|PACid:21909825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]