SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g52250.1|13101.m05464|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g52250.1|13101.m05464|protein
Domain Number 1 Region: 478-967
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.12e-110
Family Glycosyl transferases group 1 0.00000101
Further Details:      
 
Weak hits

Sequence:  LOC_Os01g52250.1|13101.m05464|protein
Domain Number - Region: 281-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0241
Family Arfaptin, Rac-binding fragment 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g52250.1|13101.m05464|protein
Sequence length 975
Comment starch synthase, putative, expressed
Sequence
MAACGAAAAEYSALLSLSCGPITRRRFAVSCRARPPGNLSAQQKKKRGKNIAPKQRSSNA
KLLLTTEENGQLPSTSLRTSMERPQKSTSSEDDTNGAISQIDEKIAAIGNEQQERSKDKH
FESDFQLEDFGEMIQNMEKNILLLNQARLQAIEDVDKILTEKEALQKKVDTLEMNLSKAL
ATKGNINTDIPGDHLEKFTKEILIESALSGGNPAHLCESPLFMELTVLKEENMLLKADAQ
FLKAKIVEFAETEEFLFKLEKERSLLDATVRELEARFLVAQTDIWKVVPLQYDVWMEKVE
NLQHMLGCLKNHVEKYAALLDQHDDLHDKIDELEASLKEGKTSEFSPYVVELLQQKLKAA
KSHHQAGHQETNTHIQVYQQLTEEFQDNLGKLIEESGRLEHSANSMPSEFWSHILLMIDG
WFLERKIPNTDARMLREMAWKRDDRICEAYFACKGAKESDVMETFLKLSLSGNSQCSSGL
HIVHIAAEMAPVAKVGGLADVVAGLGKALQTKGHLVEIVLPKYDCMQLDQITNLKVLDVV
IQSYFDGNLFSNNVWTGTVEGLPVYFIEPQHPSKFFWRAQYYGEHDDFKRYSYFSRAALE
LLYQSGKKIDIIHCHDWQTAFVAPLYWDIYATRGFSSARICFTCHNFEYQGTAPAPDLSY
CGLDVEQLDRPDRMQDNAHGRINVAKGGIVYSNIVTTVSPTYALEVRSEGGRGLQDTLKM
HSRKFVGILNGIDTGTWNPSTDRFLAVQYSATDLQGKAANKAFLRKQLGLYSEDASQPLV
ACITRLVPQKGLHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGVADQFQKNNNIRLI
LKYDEALSHCIYAASDMFIIPSMFEPCGLTQMIAMRYGSVPIVRQTGGLCDSVFDFDDET
IPVELRNGFTFARTDEQDLSSCLERAFSYYSRKPMVWKQLVQKDMQIDFSWDSPASQYEN
LYQSAVAQARGAAQT
Download sequence
Identical sequences Q5JMA1
LOC_Os01g52250.1|PACid:21910393 XP_015648269.1.37577 39947.LOC_Os01g52250.1 LOC_Os01g52250.1|13101.m05464|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]