SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g52250.2|13101.m05468|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g52250.2|13101.m05468|protein
Domain Number 1 Region: 475-964
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.08e-110
Family Glycosyl transferases group 1 0.00000101
Further Details:      
 
Weak hits

Sequence:  LOC_Os01g52250.2|13101.m05468|protein
Domain Number - Region: 281-395
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0241
Family Arfaptin, Rac-binding fragment 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g52250.2|13101.m05468|protein
Sequence length 972
Comment starch synthase, putative, expressed
Sequence
MAACGAAAAEYSALLSLSCGPITRRRFAVSCRARPPGNLSAQQKKKRGKNIAPKQRSSNA
KLLLTTEENGQLPSTSLRTSMERPQKSTSSEDDTNGAISQIDEKIAAIGNEQQERSKDKH
FESDFQLEDFGEMIQNMEKNILLLNQARLQAIEDVDKILTEKEALQKKVDTLEMNLSKAL
ATKGNINTDIPGDHLEKFTKEILIESALSGGNPAHLCESPLFMELTVLKEENMLLKADAQ
FLKAKIVEFAETEEFLFKLEKERSLLDATVRELEARFLVAQTDIWKVVPLQYDVWMEKVE
NLQHMLGCLKNHVEKYAALLDQHDDLHDKIDELEASLKEGKTSEFSPYVVELLQQKLKAA
KSHHQAGHQETNTHIQVYQQLTEEFQDNLGKLIEESGRLEHSANSMPSEFWSHILLMIDG
WFLERKIPNTDARMLREMAWKRDDRICEAYFACKGAKESDVMETFLKLSLSGNSSGLHIV
HIAAEMAPVAKVGGLADVVAGLGKALQTKGHLVEIVLPKYDCMQLDQITNLKVLDVVIQS
YFDGNLFSNNVWTGTVEGLPVYFIEPQHPSKFFWRAQYYGEHDDFKRYSYFSRAALELLY
QSGKKIDIIHCHDWQTAFVAPLYWDIYATRGFSSARICFTCHNFEYQGTAPAPDLSYCGL
DVEQLDRPDRMQDNAHGRINVAKGGIVYSNIVTTVSPTYALEVRSEGGRGLQDTLKMHSR
KFVGILNGIDTGTWNPSTDRFLAVQYSATDLQGKAANKAFLRKQLGLYSEDASQPLVACI
TRLVPQKGLHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGVADQFQKNNNIRLILKY
DEALSHCIYAASDMFIIPSMFEPCGLTQMIAMRYGSVPIVRQTGGLCDSVFDFDDETIPV
ELRNGFTFARTDEQDLSSCLERAFSYYSRKPMVWKQLVQKDMQIDFSWDSPASQYENLYQ
SAVAQARGAAQT
Download sequence
Identical sequences Q6UBQ7
XP_015648277.1.37577 LOC_Os01g52250.2|13101.m05468|protein LOC_Os01g52250.3|13101.m05465|protein LOC_Os01g52250.4|13101.m05466|protein LOC_Os01g52250.2|PACid:21910394 LOC_Os01g52250.3|PACid:21910395 LOC_Os01g52250.4|PACid:21910396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]