SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g59800.1|13101.m06360|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g59800.1|13101.m06360|protein
Domain Number 1 Region: 264-347
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.13e-27
Family Vacuolar sorting protein domain 0.0091
Further Details:      
 
Domain Number 2 Region: 310-422
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-27
Family Vacuolar sorting protein domain 0.051
Further Details:      
 
Domain Number 3 Region: 7-137
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000059
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g59800.1|13101.m06360|protein
Sequence length 447
Comment EAP30/Vps36 family domain containing protein, expressed
Sequence
MSAAAADWLPAADVTAAGRPVLTAGEVERHLVAQGDVEPEESPRLGPLRARLLVLTSHRL
IFLHEPSRSARALPLAAVVHAYPPHRKHGHNPLRSIFSSSSSSSSSHHPRVRLQISLPPS
RSEVVAVVVSKGEADVFYGRLLEAVRARAWEVVAAVAAAPAGGSSAAQGAPAEEDLAIRM
PVVGVSGILRMEQEAWESAGQNLQDAFQDLNALMSKAKEMMELAEKMRQKLLTNSSAQSN
SNDEEMGSKQDMQDWLLSVGIVSPVTKETAGALYHQQLSRQLADYIRTPLEKAGGMMALV
DVYCLYNRARGTELISPEDLLQACSLWEKFDVPVMLRKFDSGVKVIQTKTHSDDEVFARI
SSLAQKEDALQKGISPSDAAFTLGIAPALAKEHLLNAESIGILCRDVSPDGLRFYINLFN
EIDPQNMYMPKTHGVYHTWISVTAASQ
Download sequence
Identical sequences A0A0E0N3Z5 Q5N773
LOC_Os01g59800.1|PACid:21908710 XP_015618361.1.37577 LOC_Os01g59800.1|13101.m06360|protein 39947.LOC_Os01g59800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]