SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g59800.3|13101.m06362|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g59800.3|13101.m06362|protein
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000024
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g59800.3|13101.m06362|protein
Sequence length 294
Comment EAP30/Vps36 family domain containing protein, expressed
Sequence
MSAAAADWLPAADVTAAGRPVLTAGEVERHLVAQGDVEPEESPRLGPLRARLLVLTSHRL
IFLHEPSRSARALPLAAVVHAYPPHRKHGHNPLRSIFSSSSSSSSSHHPRVRLQISLPPS
RSEVVAVVVSKGEADVFYGRLLEAVRARAWEVVAAVAAAPAGGSSAAQGAPAEEDLAIRM
PVVGVSGILRMEQEAWESAGQNLQDAFQDLNALMSKAKEMMELAEKMRQKLLTNSSAQSN
SNDEEMGSKQDMQDWLLSVGIVSPVTKETAGALYHQQLSRQVIHALLVFLLHSL
Download sequence
Identical sequences LOC_Os01g59800.3|PACid:21908712 LOC_Os01g59800.3|13101.m06362|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]