SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g63800.1|13101.m06846|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g63800.1|13101.m06846|protein
Domain Number 1 Region: 29-129
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-30
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g63800.1|13101.m06846|protein
Sequence length 158
Comment pleckstrin homology domain-containing protein, putative, expressed
Sequence
MAASLWRAVMGAGASSADTDTTGGVEFWRSPERAGWLTKQGEYIKTWRRRWFVLKQGRLF
WFKDSGVTRASVPRGVIPVATCLTVKGAEDTLNRQFAFELSTPAETMYFIADSEKEKEEW
INSIGRSIVQHSRSVTDAEVVDYDSGRPAASVTADGDK
Download sequence
Identical sequences Q94DF0
LOC_Os01g63800.1|PACid:21907180 XP_015648246.1.37577 LOC_Os01g63800.1|13101.m06846|protein 39947.LOC_Os01g63800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]