SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g72320.1|13101.m07878|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g72320.1|13101.m07878|protein
Domain Number 1 Region: 261-651
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.16e-98
Family Regulator of chromosome condensation RCC1 0.00077
Further Details:      
 
Domain Number 2 Region: 13-121
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-26
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 650-720
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.07e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g72320.1|13101.m07878|protein
Sequence length 1086
Comment FYVE zinc finger domain containing protein, expressed
Sequence
MPFILCSFLLLCILVEAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKH
LRLSQVSRIVPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTL
ISHSHQRKWRTESRSDIISSGATSPRTYTRRSSPLSSPFSSNDSVHKDGSDHYRLRSPFG
SPPKNALDKAFSDVVLYAVPPKGFFPSDSNAGSVHSMSSGHSDNTNGHPRGIPMDAFRVS
YSSAISSSSHGSGHDDGDALGDVFIWGEGTGEGILGGGSSRVGSSSSAKMDYLVPKPLEF
AVRLDVQNISCGGRHAALVTKQGEIYSWGEESGGRLGHGVDCDVAQPKLIDSLAHMNIEL
VACGEYHTCAVTLSGDLYTWGDGTFKFGLLGHGNDVSHWVPKRVDGPLEGIHVSSISCGP
WHTALVTSAGQLFTFGDGSFGVLGHGDRASLSVPREVESLKGLRTVRAACGVWHTAAVVE
VMVGNSSSSNCSSGKIFTWGDGDKGRLGHGDKDSRFVPTCVAALVEPNFCQVACGHCLTV
ALTTSGHVYTMGSAVYGQLGNPQADGLLPVRVEGKLHKNFVEEISCGAYHVAVLTSRTEV
YTWGKGANGRLGHGGTDDKNTPTLVEALKDKQVRSVVCGINFTAAICIHKWVSGSDQSMC
SGCRQPFNLRRKRHNCYNCALVFCHSCSSKKSLKASLAPNPNKPYRVCDSCYSKLTKGLE
TDTNSSTKRGTVVQGFSETNEEELETRSNTQLSRLSSMESFKNMDSRYSKKNKKFEFNST
RVSPVPNGSSHWSGLNISRSFNPVFGSSKKFFSASVPGSRIVSRATSPVSRRTSPPRSTT
PTPTLGGLTSPRVIANDAKPTNDSLSHEVLNLRSQVENLTRKSHLLEVELERTTKQLKEA
IVIAGEETAKCKAAKEVIKSLTAQLKGMAERLPGGVTKNSKLPPLSGFPMPSELSSMATE
SLGSPSSVGEQISNGPNGLLASNGPSSVRIKAGHPEVGKNGSRLPEAESCHEAEWVEQDE
PGVYITLTALPGGARDLKRVRFSRKRFSETQAEQWWQENRTRVYQHYNVRMVEKSASSID
NEIASR
Download sequence
Identical sequences LOC_Os01g72320.1|13101.m07878|protein 39947.LOC_Os01g72320.1 LOC_Os01g72320.1|PACid:21903325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]