SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g03590.2|13102.m00347|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os02g03590.2|13102.m00347|protein
Domain Number - Region: 42-101
Classification Level Classification E-value
Superfamily ARM repeat 0.00256
Family PBS lyase HEAT-like repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g03590.2|13102.m00347|protein
Sequence length 162
Comment expressed protein
Sequence
MPTNSLMGRSLISKILVSCSEEILTLVQSTGSLDKCEASSEASSSVRNAISQVYDIIIKT
SSDTIPIQTLLEALLNLAAVGNDAVVSRALRMLHSVLQHLLNNRTMSNQSVTSGIMFLLS
HVLTILFTWSGTVTKSGLHSSLQCYKLRTGIRRRIFVLMHYL
Download sequence
Identical sequences LOC_Os02g03590.2|13102.m00347|protein LOC_Os02g03590.2|PACid:21920674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]