SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g04924.2|13102.m00525|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os02g04924.2|13102.m00525|protein
Domain Number - Region: 149-182
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000544
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 
Domain Number - Region: 19-77
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0569
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g04924.2|13102.m00525|protein
Sequence length 203
Comment retrotransposon protein, putative, unclassified, expressed
Sequence
MIQEMFNSRATRARSLNVLLSLTSTRKGTQTISEYFAKMKALADELAMSGKQVDAEELTA
FILNGLDDDYDSVVSALAAKTKPITLSETYAQLLNFENRLNLRREGNMTANVAGRGRGNA
PSNRGGAGRGRGGRGGFNGAGTNAGCGGRGAGQQQRSGNDTRPVCLVCYKRGHVAADCWH
RYDDSYVPDERHLAAAASYAYFF
Download sequence
Identical sequences B7EGJ8
LOC_Os02g04924.1|13102.m00524|protein LOC_Os02g04924.2|13102.m00525|protein LOC_Os02g04924.1|PACid:21923127 LOC_Os02g04924.2|PACid:21923128 39947.LOC_Os02g04924.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]