SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g20880.1|13102.m02339|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os02g20880.1|13102.m02339|protein
Domain Number - Region: 93-145
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00068
Family FCH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g20880.1|13102.m02339|protein
Sequence length 184
Comment conserved hypothetical protein
Sequence
MAGRGSPIRSTSSGCSFQRTRAAASSAPWLRCACGKAAAVNKSNTPRNPGRRWIQCGKEP
KCCSLWIWEDLLNEYVEEMVAYSHAGEDDGLRDMLRQLAEEHKEERSRMQGLVEANHRQM
QSIYQQLNDSKKKCEQLKKMLKEEKCSRSRQLYVMLFLLAIIMYFYDKSGSSRYKLILCV
YSKS
Download sequence
Identical sequences Q6Z6S6
LOC_Os02g20880.1|PACid:21920918 39947.LOC_Os02g20880.1 LOC_Os02g20880.1|13102.m02339|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]