SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g31080.1|13102.m03401|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g31080.1|13102.m03401|protein
Domain Number 1 Region: 28-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.11e-30
Family BAR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g31080.1|13102.m03401|protein
Sequence length 623
Comment hydroxyproline-rich glycoprotein family protein, putative, expressed
Sequence
MKSPLLRLKGFGHHQQHRERKSRQPQPQPTPAKLDELADAAQDVEEMRNCYDGFISAAAA
TTNGVYEFAEALEELGSCLLAKPVLNDDDDDSGRVLMMLGKAQYELQKSADRYRTNIIHT
ITTPSESLLKELQTLEEMKQQCDMKRDAYETMRASYSDKGGSRHSKTESFSTEQLDASFL
EYQEDSALFTFRLKSLKQGQFQSLLTQAARHHAAQLSFFRKGLKCLEALEPRVKAISEKH
HIDYNFSGLEDDGSDNDGYSTYDSCSDDGELSFDYEINDRDQDFLTSRGSMDFDKSDQTT
SPKPIKENKQEEAKQAEAEIVFPQLKPEFATHSAPLFAGNLLDETDRLRQMRPSSTKHSY
RLPTPVGADNPVPSGSHRLHHSAQFFETKPHAPTNLWHSSPLTKDYNGAMHNAATKPSSS
SSTDDLKKLKRESWSGPIPIKAGSGGKPFSQADHRPSPTMAYPGAMPAAKPHVRHASSSS
VSPKVSPKMSPVPPASSLKISELHLLPLPPANVDPVRPSGLVGYSGPLVSKRAPTPARAS
PKASRTASPLPRPPAALARSYSIPSNSQRTPIITVNKLLEAKHSREGSDASSPPLTPLSL
SDLCHQEKAGKAAAGNTRRKETL
Download sequence
Identical sequences Q67UP1
LOC_Os02g31080.1|13102.m03401|protein LOC_Os02g31080.1|PACid:21921895 39947.LOC_Os02g31080.1 XP_015627747.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]