SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g42134.1|13102.m04656|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g42134.1|13102.m04656|protein
Domain Number 1 Region: 7-242,291-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-62
Family BAR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 464-592
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00037
Further Details:      
 
Domain Number 3 Region: 293-333,367-438
Classification Level Classification E-value
Superfamily PH domain-like 5.69e-22
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 670-743
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-19
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g42134.1|13102.m04656|protein
Sequence length 760
Comment ARF GTPase-activating domain-containing protein, putative, expressed
Sequence
MAAFTKLEDSPMFRKQVNSMEQLSDELKQRCSNLHKGCKRFMGSLDEGYAGDLTFADALE
AFGAGQDDPVSVAIGGPVMSKFTTAFRELGTYKELLRSQVDHMLSERLMQFIDVDLHGVK
DCRQRLDRATVGYDQAREKFVSVRKGTRAEVVTGLEEDLHNAKSAFERCRFNLVHALSNI
EAKKKYEFLESISAVMDAHLRYFKQGYELLSQMEPFIHQVLTYAQQSKEMAINEQDKLAK
RIQEYRTQEEIANLRMASNVDTSTSGDGIHVVGLQSYKKIEALMQSTANGEVQIIKQGYL
FKRSENSREWKRRFFVLDSHGTLFYYGNKGQSQGAASQQTAGEGTGVFSRFRFLNQKAPT
QGDNALSCHKIDLRTSTIKIDAEENDLRFCFRVISPMKAYTLQAESGADQKDWIEKVTGV
IASLLNLPFPRQVSYGNLEAEHHGSANSVDSLSLEENKSPEGHDDIFNHLRNIPGNDSCA
ECRSPDPDWASLNLGILICIECSGAHRNLGVHISKVRSLRLDVKVWEPVIMDLFHELGND
YTNSIWEAMLPKEDQGINEFNDAILFIEKPKPTDAFSIKERYIQTKYVDKLLIAKDTNQI
TIDILEAVRTNDVRAAYRILVLADVSPNMIYDELNNDVHHDPSVTDGKLFDPASCDVKDD
SGKPEGCLQGCSLLHIACQYGHSIMAELLLLFGADINKQDFHGRTPLHHCVRRKNDALTK
HLLKRGARTTIKDGGGLTALERRMELGAITDEDLFILFVR
Download sequence
Identical sequences Q6H462
LOC_Os02g42134.1|13102.m04656|protein 39947.LOC_Os02g42134.1 XP_015625922.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]