SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g42134.3|13102.m04657|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g42134.3|13102.m04657|protein
Domain Number 1 Region: 7-221,270-294
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-52
Family BAR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 443-571
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00037
Further Details:      
 
Domain Number 3 Region: 272-312,346-417
Classification Level Classification E-value
Superfamily PH domain-like 5.46e-22
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 649-722
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-19
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g42134.3|13102.m04657|protein
Sequence length 739
Comment ARF GTPase-activating domain-containing protein, putative, expressed
Sequence
MAAFTKLEDSPMFRKQVNSMEQLSDELKQRCSNLHKGCKRFMGSLDEGYAGDLTFADALE
AFGAGQDDPVSVAIGGPVMSKFTTAFRELGTYKELLRSQDCRQRLDRATVGYDQAREKFV
SVRKGTRAEVVTGLEEDLHNAKSAFERCRFNLVHALSNIEAKKKYEFLESISAVMDAHLR
YFKQGYELLSQMEPFIHQVLTYAQQSKEMAINEQDKLAKRIQEYRTQEEIANLRMASNVD
TSTSGDGIHVVGLQSYKKIEALMQSTANGEVQIIKQGYLFKRSENSREWKRRFFVLDSHG
TLFYYGNKGQSQGAASQQTAGEGTGVFSRFRFLNQKAPTQGDNALSCHKIDLRTSTIKID
AEENDLRFCFRVISPMKAYTLQAESGADQKDWIEKVTGVIASLLNLPFPRQVSYGNLEAE
HHGSANSVDSLSLEENKSPEGHDDIFNHLRNIPGNDSCAECRSPDPDWASLNLGILICIE
CSGAHRNLGVHISKVRSLRLDVKVWEPVIMDLFHELGNDYTNSIWEAMLPKEDQGINEFN
DAILFIEKPKPTDAFSIKERYIQTKYVDKLLIAKDTNQITIDILEAVRTNDVRAAYRILV
LADVSPNMIYDELNNDVHHDPSVTDGKLFDPASCDVKDDSGKPEGCLQGCSLLHIACQYG
HSIMAELLLLFGADINKQDFHGRTPLHHCVRRKNDALTKHLLKRGARTTIKDGGGLTALE
RRMELGAITDEDLFILFVR
Download sequence
Identical sequences LOC_Os02g42134.3|13102.m04657|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]