SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os02g45980.1|13102.m05157|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os02g45980.1|13102.m05157|protein
Domain Number 1 Region: 167-549
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.53e-90
Family Regulator of chromosome condensation RCC1 0.00042
Further Details:      
 
Domain Number 2 Region: 551-620
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.73e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 16-79
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000541
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os02g45980.1|13102.m05157|protein
Sequence length 978
Comment ZR1 protein, putative, expressed
Sequence
MAGSFEGRSPAARGVEQDIALVALKKGAHLLKCGKRGKPKLCPFRLSSDEKMLMWYSKDR
EKRLNLSSVSSVVLGHKTVHSIYGSPRLMQKNVLQSNLDFSEPFFSPRQRTWSDLDYYME
KVTPDVVNRVKHSCRDIKVADKLNEQIITQLPKQKSSEGLHVAYGATSLKDIFVWGEVPG
NVLDHGDVSKANVSLPRLLNTTHIIDVQSVACGEKHAAIVTKQGEVFSWGVDNGGRLGHK
VSVSVSDPKIIESLASTRVKAIAFGAKHTCAVSISGELYEWGEGTHCLGLWGDQYQRSQW
FPHKLFGPLDGISILKIACGHWHTAIISSAGQLFAYGDGTFGVLGHGDTLTVARPKQVES
LKGVRAKAIACGPWHTAAIVERMGTVKSNAPSGKLFTWGDADRGKLGHADKKMKLVPTCV
EPLNDFDFAQVSCAKAQTIVLTITGVVFTIGSKEHGRLGNPLSEDTSICLIEGPLKTEFV
REISSGSSHIAVLTMNGKVFTWGKGTEGQLGLGDYVDRSYPTLVEALEDKQVHSIACGFN
FTMAICLHRPLSSKDQSVCSNCQLTFGFTRKKHNCYNCGSMFCNSCSNNKVSRAALAPDR
SKRYRVCDACFSQMQKVEEHRKLDPQQKIQKDEVCPIEIRSYTPKLARIFKEANAIMEKM
ASAQSPHQRSQNLAVPDHVRTLRWGLVECPSQFRCVRESIPYCSTLNKQTVSGSIVRVMN
ETMAPKPASSLLKSANDSKAELDLMENILLEEVKQLQEQVTTLAKQCRQRSLKVQLYKRK
VEETWLIAKDEAAKCKAAKDIIKVLIDQHDFLSKNLLAGEKLDNSRIMPSHIASAKSLKA
ELPDPPDKNVFTSEFQQSKSNRDHHNSRQVDRECTQPSIASMANYSVTHQNCRRTSNGST
RCTEGTDATTAPTDSNGVIEQIERGVYATVVTSPGGKKCIKRIRFSRKHFGEDQAQKWWE
ANESMIFGKYSSMEQTVG
Download sequence
Identical sequences Q6ZHD3
39947.LOC_Os02g45980.1 LOC_Os02g45980.1|13102.m05157|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]