SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g02270.1|13103.m00179|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g02270.1|13103.m00179|protein
Domain Number 1 Region: 137-257
Classification Level Classification E-value
Superfamily TPR-like 6.83e-17
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 216-345
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000114
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 351-466
Classification Level Classification E-value
Superfamily PH domain-like 0.0000376
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g02270.1|13103.m00179|protein
Sequence length 482
Comment expressed protein
Sequence
MEDSARPTPADSGELPNGAGMAEDAVVAPDAGEAPEEGEESGIANDSETNAALGAEGEPS
RALTMRELLGELKDSGEPSSGRSTLSEGNGIGSAGAERASQDSLQFSSHHDVAMDLINSV
TGVDEEGRSRQRILSFAAKRYVSAIERNPEDPDAYYNWALVLQESADNVDPDSSSSKDSL
LEEACKKYAEATRLCPTLYDAYYNWAIAIADRAKMRGRTKEAEELWKQAIMNYDKAVQLN
WNSPQALNNWGLGLQELSAIVPARDKQTIIKTAISKFRSAIQLQFDFHRAIYNLGTVLYG
LAEDTMRSAGPDVSPNDLYSQSAIYVAAAHALKPNYSVYRSALRLVRSMLPLPYLKAGYL
TAPPADNTIAPHKHWERSEFVLNHEGLQQVDASESPSSKPLGHMGRSKKYIKVAVEDIVS
VSACSDLTLPPGAGLCIETIHGPLFLVADTWESLDGWLDAIRLVYTIFARGKSDVLAGII
TG
Download sequence
Identical sequences A0A0E0NNQ4 Q10SR2
LOC_Os03g02270.1|13103.m00179|protein 39947.LOC_Os03g02270.1 LOC_Os03g02270.1|PACid:21914144 XP_015633280.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]