SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g03110.1|13103.m00286|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g03110.1|13103.m00286|protein
Domain Number - Region: 96-144
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000732
Family FCH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g03110.1|13103.m00286|protein
Sequence length 181
Comment hypothetical protein
Sequence
MAGRGSPIHSTGLSGCSFQRTRAAASSAPWLRCACGKAAVVNKSNTPRNPRRRWIQCGKE
PKCCSLWIWEDLLNEYVEEMVAYSHAGEDDGLRDMLRQLAEEHKEERSRMQGLVEANHRQ
MQSIYQQLNDSKKKCEQLKKMLKEEKCSRSRQLYVMLFLLAIIMYFYVCSVNFVAIFGAS
R
Download sequence
Identical sequences Q10SH4
39947.LOC_Os03g03110.1 LOC_Os03g03110.1|PACid:21917505 LOC_Os03g03110.1|13103.m00286|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]