SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g03990.1|13103.m00405|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g03990.1|13103.m00405|protein
Domain Number 1 Region: 125-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-20
Family Ankyrin repeat 0.00075
Further Details:      
 
Domain Number 2 Region: 319-371
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000979
Family Chromo domain 0.0021
Further Details:      
 
Domain Number 3 Region: 63-128
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000275
Family Chromo domain 0.0013
Further Details:      
 
Domain Number 4 Region: 269-316
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000962
Family Chromo domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g03990.1|13103.m00405|protein
Sequence length 388
Comment signal recognition particle 43 kDa protein, chloroplast precursor, putative, expressed
Sequence
MEAVLRHPSLSRLKPPNPNAQRTPALSITVPFRLRLPNRRLTAAAVFQDQTNPRNPASKG
GDDDEAYGEVDRIVSSRTIKNPVFAEDGSATTVTATEYLVEWKDGHEPSWIPAEAIAADV
VAEYETPWWTAAKKADAAEITALLADETLRRDPDAEDAQGRTAMHFAAGLGSEECVRALA
EAGADVGRPERAGGGLTPLHIAVGYGRPAAVRALLELGAEPEAPDGQGRTPLELVQDVLA
KTPKGNPATFERRLALEAAAKELEKAVYEWGEVEKVVDGRGEGKWREYLVEWRDGGDREW
VRAAWVAEDLVKDFDAGLEYAVAEAVVNKREAAEGEGKWEYLVKWVDIEEATWEPAENVD
AELLQEFEQRQSGVAAGGDAPPPPPVAG
Download sequence
Identical sequences A0A0E0NP96 Q8LSQ2
39947.LOC_Os03g03990.1 XP_015629751.1.37577 LOC_Os03g03990.1|13103.m00405|protein LOC_Os03g03990.1|PACid:21911963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]