SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g08860.1|13103.m01026|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g08860.1|13103.m01026|protein
Domain Number - Region: 148-233
Classification Level Classification E-value
Superfamily PH domain-like 0.0664
Family GRAM domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g08860.1|13103.m01026|protein
Sequence length 264
Comment GRAM domain containing protein, expressed
Sequence
MHPPAAAGGDHATAAPAPATGAAAATASDYAHYPRLSPEDVAPPPPPSYHAAASSAPPYS
GNPYVSSPAGGVAPASKNTMDTVKDVLGKMGKRFGEAARKTETLTGNFWQHLKTGPSITD
AAMGRVSQITKVIAEGGYDKIFHQTFDVLPDEKLKKPYACYLSTSAGPVMGVLYLSNKKL
AFCSDNPLAYKVGDKDEWSYYKVVIPHTQLRSVNPSTSRTNASEKYIQVVSVDNHEFWFM
GFVYYDSAVKNLQEALQEAQNLRA
Download sequence
Identical sequences Q8H7P4
XP_015628289.1.37577 LOC_Os03g08860.1|PACid:21914729 39947.LOC_Os03g08860.1 LOC_Os03g08860.1|13103.m01026|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]