SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g15180.1|13103.m01780|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g15180.1|13103.m01780|protein
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 192-270
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000131
Family BCR-homology GTPase activation domain (BH-domain) 0.0072
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g15180.1|13103.m01780|protein
Domain Number - Region: 389-462
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0186
Family Myosin rod fragments 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g15180.1|13103.m01780|protein
Sequence length 602
Comment PH domain containing protein, expressed
Sequence
MSASEFRIPYQQVSSSQTTENAGQFKICRCGEGDPNTNTSETGDKSPTSCPNCQVLKSGH
LLLSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPPRGNEPIVTLGGIDLNNSGSVVVKE
DKKLLTVLFPDGRDGRTFTLKAETTEELNEWRSALENALAQAPVVANTVGQNPIFSTDIA
EPAEAPAEQSDNKSIIGRPAEFALVDADGSPAFLEKALKFIEDYGVKVEGILRQSADVEE
VKRRVRDYEKGKNEFSPEEDAHVIGDCIKDLEDGSYSSDAYTESEDGDFDKEYSTDNDGP
EEDDSYDSGEDNIEEDMDDDTEHSSGGSECDNNIKTSVSDDKVKSNNSGTASNGNDQGLQ
PPKKAARTGHGAARKDLSAEEIDYCSDDETLIEKLENSKTDLQSKITKEAKENSILQASL
ERRKVELHKRRLALEKEVENLRDQLQKERNLRVSLESGLMNLRRGQASFPSTIDNKTKAD
LEEVATAEADILNLKQKGSDLRGQLNNQAQRMLISKGEIVKDGQDPLASKWNLAQKQYSN
NPLLGRLGSRTEDSGAPSALAKLTNRLNFLKERRAILASEMQNLDLARPPGPPAPAPKRN
ST
Download sequence
Identical sequences Q10NV4
39947.LOC_Os03g15180.1 LOC_Os03g15180.1|PACid:21917258 LOC_Os03g15180.1|13103.m01780|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]