SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g15900.2|13103.m01874|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g15900.2|13103.m01874|protein
Domain Number 1 Region: 55-194,224-548,623-674
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000384
Family MIF4G domain-like 0.061
Further Details:      
 
Domain Number 2 Region: 982-1039
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000028
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g15900.2|13103.m01874|protein
Sequence length 1041
Comment SH3 domain containing protein, expressed
Sequence
MLHQQCEDRNVLRYVYYYLARILSDNGAQGLSAAGGIPTPNWDALADIDAVGGVTRADVV
PRIVDQLSAESTSDDVEFHARRLAALKALTSSSTSNSEMLEKLYEIVFGILEKVADTKQK
RKKGIFTKQGGDKESIIRSNLQYASLSALRRLPLDPGNPAFLHRAVQGVEFSDPVAVRHA
LSIASEIAVRDPYSVAMALGKNAQPGGALQDILHLHDVLARVYLAKLCHSISRARVLDER
PDIKSQYSSLLYQLLLDPSDRVCFEAILCVLGKVDNTESTEERAGGWIRLTREILKLPEA
PSVASKGILSKSEKSSKARRPQPLIKLVMRRLESSFRSFSRPVLHAAARVVQEMGKSRAA
AYSLGAYDEAANLQSYSDNVESLDSDLNENSQPEATRKANPLSNGHGGMDTIAGLLASLM
EVVRTTVACECVYVRAMVIKALIWMQNPHESFEELKSIIACELADPAWPSSLLNDVLLTL
HARFKATPDMAVTLLEIARIFATKVPGKIDADVLQLLWKTCLVGAGPDGKHTALEAVTIV
LDLPPPQPGSMSGFASVDMVSASDPKSAMALQRLVQAAVWFLGENANYAASEYAWESATP
PGTALMMLDADKMVAAASSRNPTLASALTRLQRCAFSGSWEIRIAAVQALTTIAIRSGEP
YRLQIYEFLHALALGGVQSNFSELQLSNGENQGASGTGLGSLISPMLKVLDEMYRAQDDL
ARDIRQHDNSKQEWNDDELKKLYETHERLLDFVSLFCFVPRAKYLPLGPTSAKLIDIYRN
RHNISTSSGLSDPAVATGISDLMYEPKDVPKEATLIQTGIDPDLAMAWAAGLEDDVWENN
APAVDKVKDFLAGAGTDAPDVDDEEYMNSRPSVGYDDMWAKTILETYEAEDDDGRSSGGS
SPESTGSVETSISSHFSGMNYPSLFSSKPSGYGASQQTIREEPPSYSTSVLQKRESFENP
LAGRGGRSFGSHEDEDRSSGNPQSGKALYDFTAGGDDELSLTAGEDVEIEYEVDGWYYVK
KKRPGRDGKTAGLVPVLYVNS
Download sequence
Identical sequences Q10NL9
LOC_Os03g15900.2|13103.m01874|protein 39947.LOC_Os03g15900.2 LOC_Os03g15900.2|PACid:21917526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]