SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g16000.1|13103.m01890|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g16000.1|13103.m01890|protein
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.45e-22
Family Arfaptin, Rac-binding fragment 0.072
Further Details:      
 
Domain Number 2 Region: 325-382
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g16000.1|13103.m01890|protein
Sequence length 394
Comment src homology-3 domain protein 3, putative, expressed
Sequence
METLRKQASKLREHVAKQQQAVRKQFSARYNQDPSLVDEAELECHQNLQRLYNSTRAAKH
FQRSIVRGVEGFIAVSTKQMEIVKKLAEDCCRYGNDNQNFGFILARASVEFGNSHSQMEK
ERENLLKFLGEQVFEPLREMIMSAPLEDARLLTYRYQRIRQDMESQIADVMRKQLKSKES
SGNADNSVKLQHAESKLSELRTTLSALGREATAAMEAVEVQQQQVTFDRLLAMVDAERAY
HQNAADILNKLHDEMVQAKHHDEPENHYDETSSDPKTAATHEHSRSTSEDHIFTNTSEPT
RTETSEPTRTETSEPTRNGQEVHYVGEVIHPFDAQADGELSISVGDYVVVRQVAPNGWSE
GECKGKAGWFPSAYVEQRDKAPASKVIEPGLLTT
Download sequence
Identical sequences A0A0D9Z546 A0A0E0GKD3 A0A0E0NSX5 B8AKN3 Q10NK5
39947.LOC_Os03g16000.1 LOC_Os03g16000.1|PACid:21913246 XP_015627859.1.37577 OGLUM03G11730.1 LOC_Os03g16000.1|13103.m01890|protein ONIVA03G12990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]