SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g24180.1|13103.m02856|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g24180.1|13103.m02856|protein
Domain Number 1 Region: 189-382
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00087
Further Details:      
 
Domain Number 2 Region: 23-140
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g24180.1|13103.m02856|protein
Sequence length 874
Comment pleckstrin homology domain-containing protein, putative, expressed
Sequence
MSSAPAAGGAFDRYQRAGAPAASGNTVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVFF
KSDPSTLPQRGGEVNVTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSED
LFEWKTALEEALAQAPNAALVMGHNGIFRNETTDTYDGAIPNWREKRPIKSLVVGRPILL
ALEDIDGSPSFLEKALRFLEKYGIKVEGILRQAADVEEVDRRLQEYEQGRTEFAPDEDSH
IVGDCVKHVLRELPSSPVPASCCTALLEAFRLETKDARINAMRSAIVETFPEPNRRLLQR
ILKMMYTIASHTSENRMTASAVAACMAPLLLRPLLAGECEMDEVFDMDGDDSAQLLAAAN
AANSAQGIVTTLLEEYESIFDGEHNLRCSLSPESQIEDSGSEASTDDVNLDVKGNGFHDA
ENDVDQEMDDENGAERILSGKLSESSGYAGSDLYDYKVVHADDSDAERSEDAKAAEVKIE
LSKGPKSHSAENGSAYMETLLSEKNPSNPISSHETPLSMGEILSSLDPGISLANHSGEYS
VESRQPAKINGSHPHVKRSNFWGRNNARKSQHSESVDSSGEEELAIQRLEIAKNDLQNRI
AKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSSQF
SSSRAMDTKTRAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYGPMVDANDRYHRIP
GHFSQQNFVQPGFDMNLAFCNQEKQRNEESSVDSSQWRNIKQHVLPYGSSRPLTRKLSLD
ASSSDSRGMEASTSMPTDNTAMAINAPKFTEGVDYGRQPMVASSTLVELTTRLDFFKERR
SQLMEQLHSLDLGHGSASQGFPYNKPPSPWDSPR
Download sequence
Identical sequences Q10L77
LOC_Os03g24180.1|13103.m02856|protein LOC_Os03g24180.1|PACid:21913096 39947.LOC_Os03g24180.1 XP_015632744.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]