SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g44200.1|13103.m04753|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g44200.1|13103.m04753|protein
Domain Number - Region: 176-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0659
Family Arfaptin, Rac-binding fragment 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g44200.1|13103.m04753|protein
Sequence length 501
Comment beclin-1, putative, expressed
Sequence
MKPPASSAAAAGDKGGGVDPSLPRFKCQECQRALVVVGVESFTDKLPAHAVSGMNVSSVQ
GSVMGASRMDNSYVVLSKQNRSHSHGIPPRPPSAGIPRAEPNQPTRAMEGSYIVLPPAAA
SIYKTSASEGGGAQLSPTSMNPGSPLPGNNFHSSVTVLKRAFEIATSQTQIEQPLCLDCM
RLLSDKMEKEIEDVNTDNKAYEACLQRLEQETYNILSETDFQKERQKIEEEEKKLKAAIE
EAEKQYSEICSEMKCLETKSKQFEELEERYCHDLNSFQFQWISHQEERDAVLAKIEVSQV
HLELLKRTNVLNDAFYISHDGVIGTINNFRLGRLPNVQVEWDEINAAWGQAALLLHTMAQ
YFFPKFEYRIKIHPMGSYPKVTDINQNTYELFGPVNLFWSTRFDKAMTWFLTCLQEFADF
AVSLDKENNVPPDKSLKLPYKIEGDKVGSYTIFLSFNKLDNWTKALKYMLCNLKWVLYWF
IGNTSFAPPSGSLHVAQSSKG
Download sequence
Identical sequences Q60DN7
LOC_Os03g44200.1|13103.m04753|protein LOC_Os03g44200.2|13103.m04754|protein LOC_Os03g44200.1|PACid:21912622 LOC_Os03g44200.2|PACid:21912623 XP_015630388.1.37577 39947.LOC_Os03g44200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]