SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g49770.1|13103.m05411|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g49770.1|13103.m05411|protein
Domain Number 1 Region: 422-798
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.05e-118
Family Oxysterol-binding protein 0.00068
Further Details:      
 
Domain Number 2 Region: 90-121,148-227
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g49770.1|13103.m05411|protein
Domain Number - Region: 38-49
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g49770.1|13103.m05411|protein
Sequence length 804
Comment oxysterol-binding protein, putative, expressed
Sequence
MHPFCCVPPVPVSPAASAAAAATPAASSAVAGAPAVMPPPPPPLPPPPPRSNSAPPERRA
LRWAAGGGSGGGNSPPEGVKLNEIVGGGISGILYKWVNYGRGWRPRWFALHDGVLSYYKI
HGPDRIVLSRETERGAKVIGEDSLRRLSRPSTSSSSSAHSNGHHLPRKPIGEIHLKVSSV
RESRSDDRRFSIFSGTKRLHLRAETREDRAAWVEALQATKEMFPRMSTSEMVGPGDTAAA
VAVSTERLRQRLQQEGVSEAAIADSERIVRTEFEVLHKQLMLLKQKQTLLLDTLRQLETE
KVDLENTLVDESQRQSKEYGSTSRSKNEKYSEGSASESDDYNEPQDPAEDETDDDENIYF
DTRDFLSSSSFKSSGSDFQRSEAGSDDEDDYPMDGIDTSMKSVGISYPYVRRRKKLPDPV
EKEKGVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLIDRAYEWGKRGN
SLMRILSVAAFAVSGYASTDGRSCKPFNPLLGETYEADYPDKGLRFFSEKVSHHPMVVAC
HCEGTGWRFWADSNLKSKFWGRSIQLDPVGVLTLEFDDGEVFQWSKVTTSIYNLILGKLY
CDHYGTMRIQGNNEYSCKLKFKEQSIIDRNPHQVQGVVQDRSGRTVATLFGKWDESMHYV
MGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGLKEKLPPTDSRL
RPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATDTYRYLGGYWES
REKGSWEGCPDIFGQVPNDLMITD
Download sequence
Identical sequences A0A0E0GSH7 A0A0E0P066 Q8LN57
ONIVA03G32500.2 XP_015631955.1.37577 LOC_Os03g49770.1|PACid:21914301 39947.LOC_Os03g49770.1 LOC_Os03g49770.1|13103.m05411|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]