SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g51060.1|13103.m05553|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g51060.1|13103.m05553|protein
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.84e-24
Family Protein kinases, catalytic subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g51060.1|13103.m05553|protein
Sequence length 145
Comment inactive receptor kinase At2g26730 precursor, putative
Sequence
MEGREGGELGSAYKAAMLNGVTVAVKRMRDMNRVEFEEHIQMLGDLRHPNVLSPVGYHYR
REEKLIVSEFMPRGSLLYVLHGDQRPDRVVLDWPARMRIAVGVVRGMAYLHEKLGIPTMR
LVSMDGADFDAIHSCRRGHLTLLAV
Download sequence
Identical sequences Q6ASV6
LOC_Os03g51060.1|13103.m05553|protein LOC_Os03g51060.1|PACid:21917807 39947.LOC_Os03g51060.1 XP_015629638.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]