SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g52670.1|13103.m05739|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os03g52670.1|13103.m05739|protein
Domain Number - Region: 127-245
Classification Level Classification E-value
Superfamily PH domain-like 0.00688
Family GRAM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g52670.1|13103.m05739|protein
Sequence length 247
Comment GRAM domain containing protein, expressed
Sequence
MATSWAAPPPGYPYAQGQGGAQPPHPPQSTAVAVTPVSNGVGNPYVIVTPASASPSTCQS
LRKALERYGRKLEDGTRKAADTTGNIWHHLRTAPNMADAAVARLAQGTKVYAEGGHDRVF
TQAFGVVPGEQLRKAYACYLSTSSGPVIGTLYISTARLAFCSDSPISYHAPAVAVAGAAP
AHPPEAIYKVVLPLNQVKSVNPSASMTNRGERYIQIMTTDNHEFWFMGFVSYDKALKNLY
EALQRRA
Download sequence
Identical sequences Q84R37
39947.LOC_Os03g52670.1 LOC_Os03g52670.1|PACid:21917710 LOC_Os03g52670.1|13103.m05739|protein XP_015631527.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]