SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g54170.1|13103.m05935|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g54170.1|13103.m05935|protein
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily SRF-like 7.33e-31
Family SRF-like 0.00022
Further Details:      
 
Weak hits

Sequence:  LOC_Os03g54170.1|13103.m05935|protein
Domain Number - Region: 158-227
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0262
Family DsrA/DsrB N-terminal-domain-like 0.0088
Further Details:      
 
Domain Number - Region: 58-141
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0303
Family BAR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g54170.1|13103.m05935|protein
Sequence length 239
Comment OsMADS34 - MADS-box family gene with MIKCc type-box, expressed
Sequence
MGRGKVVLQRIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSSS
SNMLKTLERYQRYIYASQDAAAPTSDEMQNNYQEYVNLKAHVEILQQSQRNLLGEDLAPL
ATNELEQLESQVVRTLKQIRSRKTQVLLDELCDLKRKEQMLQDANRVLKRKLDEIDVEAA
PPQPPWNGNCSNGHGGGGGVFSSEPPQPEHFFQALGLHAVDVNQPPAPPPGGYPPEWMA
Download sequence
Identical sequences A0A0E0GTX1 A0A0E0P1F8 Q6Q9H6
XP_015631035.1.37577 39946.BGIOSIBCE012995 39947.LOC_Os03g54170.1 OsIBCD012009 LOC_Os03g54170.1|13103.m05935|protein LOC_Os03g54170.1|PACid:21912012 ONIVA03G35990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]