SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os03g62080.1|13103.m06850|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os03g62080.1|13103.m06850|protein
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000566
Family Dcp1 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os03g62080.1|13103.m06850|protein
Sequence length 387
Comment mRNA-decapping enzyme, putative, expressed
Sequence
MNRKNTENLTEDLLGGFEYQVQVPYIMYHNAADEITGIWFYDPQECEQVGYLFSRIQKAF
SRVSPKAKVSVTESEYEKPEVVPAVPSNEDTLKQPTSSIMLLDNAKYDFLSALLKGAACV
GATMDEASAVQSNKSVGMVHSSTHASPHAIPPQSPAIQSNKSFGMVHSSTQAPLAIPPQS
PAIRSNKSVGMIHSSTHASPFDIPPQSPAVQSNKSVGMIHSLTHASHLAIPPQSPALHGL
HPSQISAVPVMPHDAHRSSSTSTIQPTSLANPLFFPPMPSLQTASHAASSLCSAAPLHPP
ITVQQLQSAPLHQPFSLPTASSIQPPYGMPLLQPFPPPNPSPFLTSGVSYGRPVITRDQL
KDVLLSLCQNDEFIDMIYREFVKRQLP
Download sequence
Identical sequences Q10AY3
XP_015629175.1.37577 LOC_Os03g62080.1|13103.m06850|protein 39947.LOC_Os03g62080.1 LOC_Os03g62080.1|PACid:21916260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]