SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g03730.1|13104.m00293|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os04g03730.1|13104.m00293|protein
Domain Number - Region: 168-204
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000153
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g03730.1|13104.m00293|protein
Sequence length 261
Comment retrotransposon protein, putative, unclassified
Sequence
MASSSSTIASSPALSQPVTEKLARGNFSLWRAQVLATLRGAQMAGFVDGTKEMPAPTKIV
KKDEKDIVVPNPDYTEWVAQEQQVLSYLLLSLSREILSQVVHMNTAAGVWTAIEGMFTSQ
SRARAINTRMALATTQKGMAQANAAMPGRGGAGGQRGRGRGGGNLGSGRGTPQGSRGGAN
NQERPKCQLCGKLGHTVIKCYKRFDTSFTGEEKAANAATTSYGIDTNWYVDTGATDHVTG
ELDKLTVRDKYTGNEQVHAAN
Download sequence
Identical sequences Q6MW91
LOC_Os04g03730.1|PACid:21893476 39947.LOC_Os04g03730.1 LOC_Os04g03730.1|13104.m00293|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]