SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g32370.1|13104.m03100|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g32370.1|13104.m03100|protein
Domain Number 1 Region: 30-230
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-29
Family Arfaptin, Rac-binding fragment 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g32370.1|13104.m03100|protein
Sequence length 624
Comment hydroxyproline-rich glycoprotein family protein, putative, expressed
Sequence
MKSPLRKFRGFGLHSHRERKDHRPPPAKLDELADAAQEMEEMRNCYDSLLSAAAATMNSV
YEFAEAMEEMGTCLLEKTALNYDDDDSGRVLMMLGKAQFELQKFVDNYRTNIINTITNPS
ESLLKELQVVEEMKELCDHKRQEYEAMRAAYREKGRSRHSKTETLSSEQLQAYFLDYQED
AALFIFRLKSLKQGQFRSILTQAARHHSAQLSFFRRGLKYLEALEPHVKAVAEKQHIEYP
LNGLDDDTDNDEYSSYQGNQSDDSELSFDYEINDRDKDFPASRSSMDLDQSNQACSPEPL
KEHKQEYTEQIQADFAAPRVKLEIGTQSAPISADNVFDPSTRFRKMNTSNRTNYSYKLPT
PDDDKNSTSAHTNRSPHSDQPESKSHVAENLWHSSPLVKGFKPNSMFSGPVKMPSSTEGI
SAPLVYPYATSDFKKMKREAFSGPIPSKAGLNKPLFSATDLRAPMNYPRAMSTKSYGPGW
QSSVAPKFTPRITSLPTTSPRISELHELPRPPANVGAARPGLVGYSGPLVSRRQVPNVPT
RASPPSQTASPLPRPPAAMTRSYSIPSNSQRTPILTVNKLLEARHSRESSEVSSPPLTPI
SLADVSRRSTAETALEKTRMMETL
Download sequence
Identical sequences Q7XVM5
XP_015636885.1.37577 39947.LOC_Os04g32370.1 LOC_Os04g32370.1|PACid:21891659 LOC_Os04g32370.1|13104.m03100|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]