SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g45670.1|13104.m04582|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g45670.1|13104.m04582|protein
Domain Number 1 Region: 43-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-25
Family Arfaptin, Rac-binding fragment 0.036
Further Details:      
 
Domain Number 2 Region: 303-360
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000125
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g45670.1|13104.m04582|protein
Sequence length 369
Comment src homology-3 domain protein 3, putative, expressed
Sequence
MEALWKQASRLKEQVSRQGVFKPFGAAYGNSENAFTDESEVNLHQRLEKLYLSTRAAKHF
QRDIVRGVEGYIVTGSKQVDIGNKLSDDSQKYGTGNTCTSDNTLSKAAMYYGKARSLMEK
ERGNMLRAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAVEVSRRQNRVRES
APNGDVITKLEAAEYKLEELKSSMVGLGKEAVAAMAAVEAQQQRLTLQRLIAMVEAERAY
HQRVLEILDHLEQEMVSERQKIEAPPTPSAENYMAQPPPSYDEVNGMFASSSVDDSVTSV
DFFLGEALDSFKAESESELNLSAGDIVIVRKISTNGWAEGECKGKAGWFPHGYIERRERV
LASKVPHIF
Download sequence
Identical sequences B8ASL3 Q01IQ0 Q7XR93
LOC_Os04g45670.1|13104.m04582|protein 39947.LOC_Os04g45670.1 LOC_Os04g45670.1|PACid:21892108 XP_015633415.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]