SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os04g57140.2|13104.m11966|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os04g57140.2|13104.m11966|protein
Domain Number 1 Region: 872-1221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-120
Family Motor proteins 0.0000000000989
Further Details:      
 
Domain Number 2 Region: 347-464
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-21
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 469-557
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000117
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Domain Number 4 Region: 813-893
Classification Level Classification E-value
Superfamily Prismane protein-like 0.0000211
Family Acetyl-CoA synthase 0.021
Further Details:      
 
Weak hits

Sequence:  LOC_Os04g57140.2|13104.m11966|protein
Domain Number - Region: 245-295
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0568
Family Ubiquitin-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os04g57140.2|13104.m11966|protein
Sequence length 1248
Comment kinesin motor domain containing protein, putative, expressed
Sequence
MNGGGASGGDGYDSDGYSFAPPTPTTLSMSIPPELAGAIPLIDRFQVEGFLKAMQKQIHS
AGKRGFFSKKSVGPHVREKFTLEDMLCFQKDPIPTSLLKISSDLVSRSIKLFHVILKYMG
IDSPAIISLDERIELVAKLYKHTLKRSELRDELFAQISKQTRNNPDRAWLIRAWELMYLC
ASSMPPSKDIGAYLSEYVHYIAHGATTDSDVRVLALNTLNALKRSVKAGPRVTIPAREEI
EALLSSRKLTTIVFFLDETFEEITYDMATTVADAVEELAGIIKLSVYSSFSLFECRKVVN
GSKSSDVGNEEYIGLDDNKYIGDLLSEFKAAKDRNKGEILHCKLVFKKRLFRESDEAITD
PMFVQLSYVQLQHDYILGNYPVGRDDAAQLSALQILVEIGFVDNPESCVEWISLLERFLP
RQVAITRAKRDWELDIVSRYQLMEHLSKDDARQQFLRILRTLPYGNSVFFSVRKIDDPIG
LLPGRIILGINKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGVLHIFQFE
TKQGEEICVALQTHINDVMLRRYSKARSATSAVSQNDVSQTYKPPNIEIYEKRVQELSKA
VEESERKADLLNEELQKKTKQERDMQKELEGLRDTLQSERQSIKEVTNDLDKLKSLCDEK
DSSLQASLMEKTRLETRLKSGQGQESSNRTGVSGNHFERDTLPTVGTVNNSIEMLAKLEE
ELKSCKKELDASKELSKKLTMENNLLDQKVQRLERAKSEEKSNMERVYEDECCKLKSRIA
ELEQKLESRTRSLNVTESTLALRNAEVDTLQNSLKELDELREFKADVDRKNQQTAEILKR
QGAQLIELENLYKQEQVLRKRYYNTIEDMKGKIRVFCRLRPLNDKELIEKDKNIVCSPDE
FTVAHPWKDDKSKQHIYDRVFDANTTQEEVFEDTKYLVQSAVDGYNVCIFAYGQTGSGKT
FTIYGSENNPGLTPRATSELFRVIKRDGHKYSFSLKAYMVELYQDNLVDLLLAKNATHQK
LEIKKDSKGVVTVENVTVVNISSFEELRAIILRGSERRHTAGTNMNVESSRSHLILSIII
ESTNLQTQSYARGKLSFVDLAGSERVKKSGSAGKQLKEAQSINKSLSALADVIGALSSDG
QHIPYRNHKLTMLMSDSLGGNAKTLMFVNVSPAESNLEETYNSLMYASRVRCIVNDTSKH
VAPKEIMRLKKLIAYWKEQAGKRSEDDDLEEIQEERTPKEKADNRLTS
Download sequence
Identical sequences Q7XPJ0
LOC_Os04g57140.2|PACid:21893107 XP_015636574.1.37577 LOC_Os04g57140.2|13104.m11966|protein 39947.LOC_Os04g57140.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]