SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g06470.1|13105.m00693|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g06470.1|13105.m00693|protein
Domain Number 1 Region: 20-89
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000307
Family Ran-binding domain 0.025
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g06470.1|13105.m00693|protein
Domain Number - Region: 124-225,338-482
Classification Level Classification E-value
Superfamily ARM repeat 0.00158
Family HEAT repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g06470.1|13105.m00693|protein
Sequence length 539
Comment suppressor of Mek, putative, expressed
Sequence
MGEEEQGPRRKQAGPDDAVQISMQRVKVYRLTDDGKWDDQGTGHVTIDYIEGSREIALTV
VDEEDSDTLLLHHITSDDIYRKQEGRVCVPYNEIYNLMSLMHLLFLYPTVQEAAPPAAFE
SLEASRNPPFHDESLSSTSRELKKLPPLDLSSLSSILKTILECSMTERMRVSVAELILQY
HDFFPQLVNLFRTCESSGNMDALHMIFRLVKGIILLNSSAIYDKIFSDDFILEIIGALEY
DPEARTVQNHRTFLKEHVVFKEAIPIKNASVVSKIHQTYRIGYIKDVILPRVLDDSTMAS
IAAIIHANNAAVLFLLEFCTLTKSLQAVQQLRLSRDLASEGVFDIMSDVLQSQDKVLVSA
GTDILVYFLNQDPNLLRSYIARQENSQEGNSLLGLLVQGMVTDFGEGMHCQFLEILKILM
DGFATNMPTNYDELLLSHVIKFNSLKPIIEVFVENGDRYNMLHSVVLELLEYIRKENLNS
LVIHVTKSFWDQLVRFEKLGSIQAFKLKYQQVETYSSVYSCILLLLLPHLNASPCLLAS
Download sequence
Identical sequences 39947.LOC_Os05g06470.1 LOC_Os05g06470.1|13105.m00693|protein LOC_Os05g06470.1|PACid:21940976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]