SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g10440.1|13105.m01122|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g10440.1|13105.m01122|protein
Domain Number 1 Region: 494-638
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000000000343
Family Adenain-like 0.015
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g10440.1|13105.m01122|protein
Domain Number - Region: 684-719
Classification Level Classification E-value
Superfamily SH3-domain 0.0697
Family SH3-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g10440.1|13105.m01122|protein
Sequence length 781
Comment transposon protein, putative, CACTA, En/Spm sub-class
Sequence
MSQQGELMSMTTSGSSRARTPRTGNKILKERFRITTVNQVGLPIGPRKILSRFRFICGVI
GRQKFSIPQDDIKQVPAAEKDSAWLAFKESFDYPVEHENLIRQAAFKVMGNAWKNFKNQR
VYEAIKELVAEQQTSQEASSQRREDDLLTKVLGNKVHCGRTRGVGSSVPWKYGFPDYAWQ
YKKRTSNKAEKDARLEAKIRASIRAELTSEFDEKLESMRAKIRQKIQEEQQNPQAAAAVA
HEELGSPTQKRSSCASTELAENPTSVNSAIDHIMEPTSCTLTVRVMPTFTVPAAEGLAYK
PTPETRVHGLQLRGDCAKVQVDSVKPEYELFPLRYPPNDEVLSLGNARGTFIQWPKDHIE
IRVTARPTTAPGGHPPKRPASAPSAPPAQDRPAQSYDVQLQYDTDFREDRTEADSKAIHE
PPPMKKSRKAHSSPHRITLDKPEAKGRGRGGKVQASLLALRKLDLGKGQEDTKGKEDLHV
YYMEKSNTRRPNKTTDILGEHDGKPFLGPTNYIMVDFKDLFDLYRLRAVDTSLLKCYSLL
SWQWCQKNAPEVAFLDPQVVTVTNIQNDRQGMTPIQLAIDEAWAQYVQRGCLRKTGHDTL
IHKKDFPVKQQIGDQCGFHVCHNMRLLYREKVKTLAEFEWSLVPLPEEKGEYTMLLYKWT
HDSYEDEAKFAKLQAWVCGEYARKGFVEVDYDYFANREDAIRLNKEAQVEVLGHWSDHHY
PSHTDLDDEDWKLEINQSNEVYPGETELKKDATSRLSINSEEYPIVYVSLFTQVSDPTLD
V
Download sequence
Identical sequences 39947.LOC_Os05g10440.1 LOC_Os05g10440.1|PACid:21941329 LOC_Os05g10440.1|13105.m01122|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]