SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g16640.1|13105.m01753|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LOC_Os05g16640.1|13105.m01753|protein
Domain Number - Region: 677-714
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0193
Family BAR domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g16640.1|13105.m01753|protein
Sequence length 722
Comment DUF630/DUF632 domains containing protein, putative, expressed
Sequence
MGSSPSKATGEDALVLCKERMRHIRRAIDSRDALSASHLSYTQSLRSVGTALRRYAESEI
SPESSLSISEADKSPSHSSMASPSPSRAVESTGSPVHRGSQLTPPSTKIHYMKAAGTKPL
TFTIDPSAADFVGQESPVSTFVPPPPPLPPELCTSWDFFDSNYTSGSATSNNENGVTLNF
SRLKGLRDSRESEAVSLREETTNRSDRMHPELPGDNAAPKQEAQAKKGGMSKPSGSVEVT
TEATTSGQVGAKVEEDDMEKELCTEAEDPSEFITHRAKDFVSSMKDIETRFVRAAEAGNE
VSRMLETKKIRLDICAKIPGSPGKPPTARFVSALRVCCNRENILNQETAQNISKVVTWKR
SVSSLSSSSKSPLTAAMITDDVGDSNSDFVEQFAMVSGSHSSTLDRLHAWERKLHDEIKA
SEHVRKTYDEKCNLLRRQFARGLNAQLIDKTRAVVKDLHSRVSVAIQAVDAISKRIEKIR
DEELQPQLVELIQGLIRMWKAMLECHHKQFITISLAYHVKSSTMVQQGEHHRRAAAHLWN
ELDCFSSSFRIWVTAHKSYVESLNAWLQKCVLQPAQDRRRRKRKVSFPPRHALSPPIFVL
CRDWLAMMESQSLPTDELCKSIKEVMQLLRGSFDHPADHQDKTTTESQSRNESQECGMLE
NNEQEVSGSVEAVEGLQSKLTTVLDRLTKFSEASLKHYEELKQNYEIARDDYQTGRSNAH
LV
Download sequence
Identical sequences A0A0E0PJN1
XP_015637808.1.37577 39947.LOC_Os05g16640.1 LOC_Os05g16640.1|PACid:21939994 LOC_Os05g16640.1|13105.m01753|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]