SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g27920.1|13105.m02869|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g27920.1|13105.m02869|protein
Domain Number 1 Region: 125-225
Classification Level Classification E-value
Superfamily PX domain 7.19e-22
Family PX domain 0.0039
Further Details:      
 
Weak hits

Sequence:  LOC_Os05g27920.1|13105.m02869|protein
Domain Number - Region: 299-354,382-525
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000173
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g27920.1|13105.m02869|protein
Sequence length 540
Comment phox domain-containing protein, putative, expressed
Sequence
MMSSTAPPDMPAGDGDGDMETLPLASDYASVASTFDPLLSSAAAAASPPSPTIAAAAAFP
LSPSSSSSFVDPPSYADVAASSSSSPRSASASASASPRSAASDYALIAVSDPTPEAEPAA
TSLVPGSAPTYISYLVTSARRGDHRRHAVRRRFRDFVTLADRLAEAFRGHFVPPRPDKNT
VESQVMQRDEFVAQRRAALERYLWRLAEHPAIGPSDELRVFLQAEGKMPLPSTTDVASRM
LDGAARLPRQLLAGEEAVAAPQEVVQPAKGGRDLLRIFKELKQSVVSDWGGVRPPLVEED
KEFLDKKQKLQDWEQQLTSASQQAEALVKAQQDMGETMGALGLAFIKLTKFETEEAMYDS
QRIRAADSKRIATAAVKASRACRDLNTQTVKYLDTLHEHLGIMLSVHTAFSDRSSALLTV
QTLMSDLASLQLRIEKLEAAASKIFGGDKSRLRKVEELRETIRATEDAKCCALREYERIK
ENNRSELNRLDREKKEDMLEMIKGYVTSQAAYAEKIVEGWETVAEETSGYARRSDNNIAW
Download sequence
Identical sequences A0A0E0PL20 Q5W6R5
39947.LOC_Os05g27920.1 LOC_Os05g27920.1|PACid:21938821 XP_015639649.1.37577 XP_015639650.1.37577 LOC_Os05g27920.1|13105.m02869|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]