SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g28290.1|13105.m02912|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g28290.1|13105.m02912|protein
Domain Number 1 Region: 37-163
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-44
Family Ran-binding domain 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g28290.1|13105.m02912|protein
Sequence length 220
Comment ranBP1 domain containing protein, expressed
Sequence
MADKEPVVDRPEDEEEASAAAAAAGGEEEDTGAQVAPIVRLEEVAVTTGEEDEDVLLDMK
AKLYRFDKEGNQWKERGTGTVKLLKHKENGKVRLVMRQAKTLKICANHLVASTTKMQEHA
GSDKSCVWHAADFADGELKEEMFAIRFGSVENCKKFKDLVEEISESLAKTEGKETEEDSS
AAGLLEKLSVTEKKSEEVATKEESTEAVKETDTKSAATSE
Download sequence
Identical sequences A0A0E0PL50 Q0DIY4
39947.LOC_Os05g28290.1 XP_015640665.1.37577 LOC_Os05g28290.1|13105.m02912|protein LOC_Os05g28290.1|PACid:21941421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]