SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os05g29050.2|13105.m03004|protein from Oryza sativa ssp. japonica 5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os05g29050.2|13105.m03004|protein
Domain Number 1 Region: 390-558,601-647
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.02e-39
Family Phospholipase D 0.058
Further Details:      
 
Domain Number 2 Region: 788-1007
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.46e-28
Family Nuclease 0.051
Further Details:      
 
Domain Number 3 Region: 300-410
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000295
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOC_Os05g29050.2|13105.m03004|protein
Sequence length 1164
Comment phospholipase D p1, putative, expressed
Sequence
MNVERLVPGGAGGGGGRFRYERMPARGPADDGEGEEEEEEAAVPERRPEVLAASASFRLS
EAARVFEELPRASIVAVSRPDAGDITPMLLSYTIEVHYKQRYLIRHNQFKIKKLTNLEDI
SNIDWSAMFRWRLYKKASQVLYLHFALKRREFLEEFHEKQEQVKEWLQNLGIGEHMPVGH
DEDEADDVNVPAQAEENSIRHRNVPSSAVLPVIRPALGRQHSVSDRAKVAMQEYLNHFLG
NLDIVNSPEVCKFLEVSCLSFLPEYGPKLKEDYVSVGHLPKIQKDHKENCCSCGLFSCCK
SSWQKVWVVLKPGFLALLKDPFDPKLLDVLIFDALPHMDISGEGQISLAKEIKERNPLHF
GLQVSSGGQTLKLRTRSSSKVKDWVSAINAARQTPEGWCYPHRFGSFAPPRGLMPDGSMV
QWFIDGEAAFQAIASSIEQAKSEIFITGWWLCPELFLRRPFQHHGSSRLDALLEARAKQG
VQIYILLYKEVALALKINSLYSKQKLLNIHENVKVLRYPDHFSSGVYLWSHHEKIVIVDN
QVCYLGGLDLCFGRYDNSAHKLSDVPPVIWPGKDYYNPRESEPNSWEDTMKDELDRTKYP
RMPWHDVQCALYGPPCRDVARHFVQRWNYAKRNKAPNEQGIPLLMPHHHMVIPHYKGIGQ
EINSEADGKQNHDKDCDVKKPVSVDSRESCQDIPLLLPQELEPPALPNGDLRVNDLDANH
SDHLHKTSFNQPLLNRKAKLDSSRQDLPMRGFVDNISSLESSSIRHFDSSKEEKYHMDKN
WWEMQERGDQVASVLDIGQVGPRATCHCQVIRSVGQWSAGTTQIEGSIHNAYFSLIEKAE
HFVYIENQFFISGLSGDETIKNRVLEALYRRILRAEREKKRFKAIIIIPLLPGFQGGIDD
GGAASVRAIMHWQYRTICRGPNSILQNLYDVIGPKAHDYISFYGLRAHGRLCEGGPLVTN
QIYVHSKLMIIDDRITLIGSANINDRSLLGSRDSEIAVVIEDKEVVSSKMNGKPWEAGKF
SLSLRLSLWAEHLGLHRGEVSHIMDPIDDSTFKNIWMATAKTNTMIYQDVFSCVPNDLIH
SRAQFRQSFAHCRDKIGHNTIDLGVAQEKLETYQDGDLKGTDPIERLQMIKGHLVSFPLD
FMSQEDLRPYFSESEYYTSPQVFH
Download sequence
Identical sequences LOC_Os05g29050.2|13105.m03004|protein 39947.LOC_Os05g29050.2 LOC_Os05g29050.2|PACid:21938675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]